Labs RSS GitHub • GPL-3.0
CRV Science Labs • bio-suite v0.2.0 (Rust / GPL-3.0)

Bioinformatics, Systematics & Emergent Genome Complexity

High-throughput multi-threaded Rust worker-agent pipelines for molecular phylogenetics, structural genomics, target discovery, and information-theoretic sequence complexity.

← Return to CRV Science Labs / Drug Discovery & Functional Genomics
#4 ★ 1★ Baseline / Review Note Drug Discovery & Functional Genomics

Cryptic Biosynthetic Gene Cluster & AMP Miner Baseline: MIBiG Dereplication and Embedded Self-Resistance GyrB Duplication De-Orphan a Marine Streptomyces NRPS-PKS & sORF Peptide Pair

Running the CRV Science Labs Rust bio-suite bgc-mine pipeline filters known polyketide rediscoveries while pairing an orphan 46.5 kb hybrid NRPS-T1PKS cluster with its embedded Asn426/His136 self-resistant gyrB target paralog and profiling a 31-aa amphipathic antimicrobial peptide.

By Bryan P. White • 9 min read • High (Graduate / Technical Monograph)
🧪 Reproducible Worker-Agent Pipeline Provenance (GPL-3.0)
Repository: https://github.com/bpwhite/crvscience-labs.git  |  Pipeline ID: bgc-mine-v1
CLI Command: bio-suite bgc-mine --out runs/bgc-mine-report.json

1. Abstract & Target-First Natural Product Mining Strategy

Marine actinomycetes, soil myxobacteria, and filamentous fungi encode thousands of cryptic biosynthetic gene clusters (BGCs)—including Non-Ribosomal Peptide Synthetases (NRPS), Polyketide Synthases (PKS), and ribosomally synthesized and post-translationally modified peptides (RiPPs)—that remain transcriptionally silent in standard laboratory monocultures[1]. Historically, natural product discovery suffered from two major bottlenecks: (i) high rediscovery rates of known scaffolds (such as streptothricin, erythromycin, or actinomycin), and (ii) unknown molecular mechanisms of action (MoA) for newly isolated secondary metabolites.

Pipeline 4 (bio-suite bgc-mine) resolves both bottlenecks computationally before wet-lab heterologous expression. First, it combines short-ORF calling (Prodigal-gv tuned for sORFs < 100 amino acids) with rule-based and CRF/Transformer BGC detection (antiSMASH 7[1] and GECCO[2]), filtering out known clusters that share ≥ 80% domain-architecture Jaccard similarity against the MIBiG v3.1 reference database via BiG-SCAPE[3]. Second, it applies the Antibiotic Resistant Target Seeker (ARTS) evolutionary principle[4]: an organism synthesizing a lethal toxin must encode a mutated, resistant paralog of its own essential housekeeping target gene inside the BGC to prevent suicide. Third, for short RiPP/AMP candidates, it computes the 11-residue helical-wheel Eisenberg amphipathic hydrophobic moment (μH)[5], net charge at pH 7.4, and Boman protein-binding index alongside Macrel[6] and ESMFold structural folding.

2. MIBiG Dereplication & Prioritized Natural Product Dossiers

Across the marine sediment metagenome-assembled genome benchmark (Streptomyces sp. SCSIO-64), Step 1 detected three candidate clusters. Step 2 automatically dereplicated and discarded Cluster-01 after computing a 92.4% domain Jaccard similarity to known Erythromycin A (BGC0000055), while retaining two orphan scaffolds that passed the < 0.80 novelty gate: BGC-NRPS-SCSIO64-02 (Jaccard = 0.342) and BGC-RIPP-SCSIO64-03 (Jaccard = 0.185). Click Copy for Excel (TSV) to export the BGC dereplication and target-mining summary:

📊 Pipeline 4 (bgc-mine-v1) — BGC Detection, MIBiG v3.1 Dereplication & ARTS Target Hook Summary
Cluster ID Contig Region Length (kb) BGC Structural Class Nearest MIBiG Hit MIBiG Jaccard Sim Novelty Gate (<0.80) Embedded Target / Hook MedChem Priority Score
BGC-T1PKS-SCSIO64-01NODE_1:24,100..78,50054.40Type-I Modular Polyketide (T1PKS)BGC0000055 (Erythromycin A)0.9240FILTERED (Known)ermE 23S rRNA methyltransferase14.2
BGC-NRPS-SCSIO64-02NODE_4:118,400..164,92046.52Hybrid NRPS / Type-I PKSBGC0001555 (Cinnabaramide A)0.3420PASSED (Novel)gyrB2 (Asp426Asn / Arg136His)94.6
BGC-RIPP-SCSIO64-03NODE_11:42,100..51,8509.75Class II sORF RiPP / Cationic AMPBGC0000581 (Microcin J25)0.1850PASSED (Novel)SCSIO64_sORF_1942 (31-aa AMP)88.4

3. Self-Resistance Target De-Orphaning (GyrB2) & sORF AMP Biophysics

Within BGC-NRPS-SCSIO64-02 (NODE_4:118,400..164,920, encoding core modules A(Pip)-PCP-C, A(dhb)-PCP-E, KS-AT(mmal)-KR-ACP, and C-A(Orn)-PCP-TE), the ARTS scanner identified a duplicated copy of the essential housekeeping gene gyrB (DNA Gyrase Subunit B, TIGR01059). Whereas the canonical chromosomal housekeeping copy resides at SCSIO64_00142, the BGC-embedded paralog SCSIO64_02189 exhibits 19.8% amino-acid divergence and carries two classic ATP-binding pocket resistance substitutions—Asp426Asn and Arg136His—directly predicting that the hybrid depsipeptide-polyketide product acts as a competitive GyrB ATPase inhibitor.

In parallel, biophysical profiling of the 31-aa cryptic peptide SCSIO64_sORF_1942 inside BGC-RIPP-SCSIO64-03 confirms an amphipathic cationic α-helical hairpin architecture capable of Gram-negative outer-membrane disruption:

📋 Cryptic sORF Antimicrobial Peptide Biophysical Telemetry (BGC-RIPP-SCSIO64-03)
sORF ID Peptide Sequence (1-Letter IUPAC) Length (aa) Net Charge (pH 7.4) Eisenberg Moment mu_H Boman Index (kcal/mol) ESMFold pLDDT Membrane Disruption Prob
SCSIO64_sORF_1942GIGKFLHSAKKFGKAFVGEIMNSKWRKVGRK318.10.68620.619489.40.8511

4. Medicinal Chemistry Outlook & 1★ Signal Rating Assessment

Pairing domain-architecture dereplication with embedded self-resistance target mining turns genome mining from a blind isolation exercise into a mechanism-guided drug discovery workflow. A medicinal chemistry team prioritizing BGC-NRPS-SCSIO64-02 knows prior to fermentation or total synthesis that the encoded metabolite targets the bacterial GyrB ATPase lid.

Signal Rating Assessment (1★ Baseline / Review Note): This report is rated 1★ because it evaluates the deterministic reference benchmark dataset included with bio-suite bgc-mine (n = 3 clusters in a single actinomycete reference assembly) without wet-lab LC-MS/MS metabolomic confirmation, heterologous expression in Streptomyces coelicolor, or minimum inhibitory concentration (MIC) bioassays.

References & Primary Sources

  1. [1] Blin, K., Shaw, S., Augustijn, H. E., et al. (2023). antiSMASH 7.0: new and improved predictions for detection, regulation, chemical structures and visualisation. Nucleic Acids Research, 51(W1), W46–W50. https://doi.org/10.1093/nar/gkad344
  2. [2] Carroll, L. M., Larralde, M., Fleck, J. S., Ponnudurai, R., Milanese, A., Cappio, E., & Zeller, G. (2021). Accurate de novo identification of biosynthetic gene clusters with GECCO. bioRxiv / EMBL. https://doi.org/10.1101/2021.05.03.442509
  3. [3] Terlouw, B. R., Blin, K., Navarro-Muñoz, J. C., et al. (2023). MIBiG 3.0: a community-driven effort to annotate experimentally validated biosynthetic gene clusters. Nucleic Acids Research, 51(D1), D603–D610. https://doi.org/10.1093/nar/gkac1049
  4. [4] Mungan, M. D., Alanjary, M., Blin, K., Weber, T., Medema, M. H., & Ziemert, N. (2020). ARTS 2.0: feature updates and expansion of the Antibiotic Resistant Target Seeker for comparative genome mining. Nucleic Acids Research, 48(W1), W546–W552. https://doi.org/10.1093/nar/gkaa374
  5. [5] Eisenberg, D., Weiss, R. M., & Terwilliger, T. C. (1982). The helical hydrophobic moment: a measure of the amphiphilicity of a helix. Nature, 299(5881), 371–374. https://doi.org/10.1038/299371a0
  6. [6] Santos-Júnior, C. D., Pan, S., Zhao, X.-M., & Coelho, L. P. (2020). Macrel: antimicrobial peptide screening in genomes and metagenomes. PeerJ, 8, e10555. https://doi.org/10.7717/peerj.10555